PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7BS_1B525AFF5.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 777aa    MW: 88522.4 Da    PI: 6.8633
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7BS_1B525AFF5.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR168.61.5e-2154140290
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                             Y++Y++++GFsvrk k+++   ++ i +++++Cskeg + +e  +  +++ +r+ trt+Cka+++ + +++g+w v++++  HnH+l
  Traes_7BS_1B525AFF5.2  54 LYCDYGHRIGFSVRKGKQSYFIGTRDIRTKDYYCSKEGLKYDEPVT--EANFNRPDTRTNCKAMVRFRVDEKGRWTVIRFVPLHNHQL 139
                            7********************9999****************99988..9999***********************************9 PP

                   FAR1  90 a 90 
                            a
  Traes_7BS_1B525AFF5.2 140 A 140
                            7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.5E-1954140IPR004330FAR1 DNA binding domain
PfamPF105516.3E-32262355IPR018289MULE transposase domain
PROSITE profilePS509669.186543579IPR007527Zinc finger, SWIM-type
PfamPF044344.4E-6544576IPR007527Zinc finger, SWIM-type
SMARTSM005756.0E-6554581IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 777 aa     Download sequence    Send to blast
MDTRPGSQEE LLRMRKNGEE GKKGEDHGNA LSRKEATEEL IGCMVHSEEE AYKLYCDYGH  60
RIGFSVRKGK QSYFIGTRDI RTKDYYCSKE GLKYDEPVTE ANFNRPDTRT NCKAMVRFRV  120
DEKGRWTVIR FVPLHNHQLA KPGERHLLRS AKSFAVGKSG VIDPAESAES HAMNGSSDRT  180
VGDISEPPGY TTRDCYNHDN VQNITLIGAG DSQSLVSYFK RRTNEEGMFY WDVQVDQEGR  240
MTNFFFRDGK SRSDYDCFGD AVIFDTTYRT NKYSLICAPF VGVNHHWHNV VFGFAFLLDD  300
STASYVWLFK SFLESMGGQS PKSIFTDQDE AIMQAAEQVF PNTQHCFSYW HILKNAQSHL  360
GTVNTSQAFQ NMFMKCMQGC DTEMELQESW DAMLDEYKLQ DNDWLNGLYK FHNRWCSVFN  420
EDTFDGGINS SQWGEVSNNI LTGIADESTS LTRFSLLVEK VVKTLRRNES EEDFRCSQTA  480
PVRAIKHSTV LKQAAESYTH RMYKLFEAEF LDGCGATSCH ENSCGGSLLR FEITMQGRGS  540
KMWTVLLDTS TMEISCGCRK FERMGLLCSH ALKAFSLQNV DMVPEKYILK RWTKDARRSM  600
YNLNQEDSTQ QECTEAELAY RNRAMQYAYN LALKSQELEE ARKIFWDSLE TGEKALEVFF  660
EMRSLHAQSA KDASTREKKK KKIPKGPSTK KAKQALASSS AAPVLTAQTN EQQFQSAQDA  720
NGNATIGRSY YYQVFPTPMQ PNQIFMHPNT MPVCAPQDLS AYAVVRPNSN FGGAKNI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3711050.0AK371105.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2125C10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561049.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 9-like
TrEMBLW5HSU90.0W5HSU9_WHEAT; Uncharacterized protein
STRINGMLOC_13034.80.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-97FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]